PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn270781
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 288aa    MW: 31051.8 Da    PI: 6.9161
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn270781genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.81.6e-3094147155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Achn270781  94 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 147
                 59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.05991150IPR017930Myb domain
SuperFamilySSF466892.6E-2091151IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-3093152IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-2495147IPR006447Myb domain, plants
PfamPF002491.1E-797146IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MREEDSSNWF SKWEEELPSP EELMPLSQTL ISPDLAIAFD IRSPNSPQHP PQPPPPLPLP  60
PSASPQPNSS EFDSADLGGG AASNGDEPAR TLKRPRLVWT PQLHKRFVDA VAHLGIKNAV  120
PKTIMQLMSV DGLTRENVAS HLQKYRLYLK RMQGLSAGGG GASGGDPATD HLFASSPVPS  180
HFLHPGRPSS DHFLPFVPVA AHHHHQMAAA AAVAGHQPQY RQMGHFGSQS NGHFEHPFLA  240
RPSQPVHRIG APLHNPVPSS YVEDMESATA ANGRKVLTLF PTGDDSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-2093152463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036386.11e-131PREDICTED: transcription factor PCL1-like
SwissprotQ9SNB47e-48PCL1_ARATH; Transcription factor LUX
TrEMBLA0A124SFJ41e-133A0A124SFJ4_CYNCS; Uncharacterized protein
STRINGSolyc10g080960.1.11e-122(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.15e-87G2-like family protein